PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.008G133700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 241aa    MW: 27421.1 Da    PI: 8.1197
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.008G133700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.18.8e-181057148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT++Ed++lv+ v+++G ++W+ Ia+  g++Rt+k+c++rw +yl
  Sobic.008G133700.1.p 10 KGPWTEQEDLQLVCTVRLFGERRWDFIAKVSGLNRTGKSCRLRWVNYL 57
                          79********************************************97 PP

2Myb_DNA-binding54.72.3e-1763108148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           rgr+++ E+ l++++++++G++ W++Iar+++ gRt++++k++w++++
  Sobic.008G133700.1.p  63 RGRMSPHEERLILELHARWGNR-WSRIARRLP-GRTDNEIKNYWRTHM 108
                           89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.259557IPR017930Myb domain
SMARTSM007171.9E-15959IPR001005SANT/Myb domain
SuperFamilySSF466893.95E-299104IPR009057Homeodomain-like
PfamPF002491.7E-161057IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-191164IPR009057Homeodomain-like
CDDcd001671.23E-111257No hitNo description
PROSITE profilePS5129425.55258112IPR017930Myb domain
SMARTSM007172.2E-1662110IPR001005SANT/Myb domain
PfamPF002494.3E-1563107IPR001005SANT/Myb domain
CDDcd001676.13E-1265108No hitNo description
Gene3DG3DSA:1.10.10.601.0E-2365111IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MVTVREETRK GPWTEQEDLQ LVCTVRLFGE RRWDFIAKVS GLNRTGKSCR LRWVNYLHPG  60
LKRGRMSPHE ERLILELHAR WGNRWSRIAR RLPGRTDNEI KNYWRTHMRK KAQERKRNMS  120
PSSSSSSLTY QSGYPDTPST IGVEGQELHG GSGCITSILK GTPPDMDGYP MDQIWMEIEA  180
PEVPSEVGFV GGNENVCSSL ATPLPPPTVW EYYPEACWKI DDEIKMAPQF SYSEGAGPCF  240
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-2771121105MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-27101124105C-Myb DNA-Binding Domain
1msf_C1e-27101124105C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.91430.0shoot
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00600PBMTransfer from AT5G59780Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0391310.0BT039131.1 Zea mays full-length cDNA clone ZM_BFb0374B19 mRNA, complete cds.
GenBankHQ8586750.0HQ858675.1 Zea mays clone UT1131 MYB transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008664593.11e-166PREDICTED: uncharacterized protein LOC100194394 isoform X3
SwissprotQ4JL761e-130MYBA2_ORYSJ; Myb-related protein MYBAS2
TrEMBLB6TH071e-167B6TH07_MAIZE; MYB59
STRINGSb08g018580.11e-180(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63637169
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.38e-77myb domain protein 59